PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01616.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 189aa    MW: 20857.4 Da    PI: 11.4765
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01616.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.88.8e-21135179751
                                   HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF   7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                   s + vt+skR ng+ KKA+ LSvLCdae+a+ ifs++gklye++s
  Zpz_sc01616.1.g00080.1.am.mk 135 SLAPVTYSKRHNGLQKKAFDLSVLCDAEIALFIFSTQGKLYEFAS 179
                                   5678***************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-13122180IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.736139181IPR002100Transcription factor, MADS-box
PfamPF003192.4E-16139177IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-17139181IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-15143158IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-15158179IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MSVAVGVVLQ QPLLTIRARR PRSYSRVFVC VLWRQRSPVG DTVALPCARP APRAPRLARS  60
LPPARHHPLH TLAPCRREGP NPVRALTLSL CQSPPPRLPI SAAAAADLPR LAEMNNRRAL  120
SPDRATHQLL LPLSSLAPVT YSKRHNGLQK KAFDLSVLCD AEIALFIFST QGKLYEFAST  180
RYEVATYPS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.24e-17MIKC_MADS family protein